Recombinant Full Length Human HIST2H3A Protein, GST-tagged

Cat.No. : HIST2H3A-3601HF
Product Overview : Human HIST2H3A full-length ORF ( NP_001005464.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 136 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy. [provided by RefSeq
Molecular Mass : 41.8 kDa
AA Sequence : MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST2H3A histone cluster 2, H3a [ Homo sapiens ]
Official Symbol HIST2H3A
Synonyms HIST2H3A; histone cluster 2, H3a; histone 2, H3a; histone H3.2; H3/n; H3/o; histone H3/m; histone H3/o; HIST2H3C; HIST2H3D;
Gene ID 333932
mRNA Refseq NM_001005464
Protein Refseq NP_001005464
UniProt ID Q71DI3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIST2H3A Products

Required fields are marked with *

My Review for All HIST2H3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon