Recombinant Full Length Human HIST2H2AC Protein, GST-tagged

• Cat.No.: HIST2H2AC-3598HF
• Product Overview: Human HIST2H2AC full-length ORF ( NP_003508.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.4 kDa
• Protein length: 129 amino acids
• AA Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST2H2AC histone cluster 2, H2ac [ Homo sapiens ]
• Official Symbol: HIST2H2AC
• Synonyms: H2A; H2A/q; H2AFQ; H2A-GL101
• Gene ID: 8338
• mRNA Refseq: NM_003517
• Protein Refseq: NP_003508
• MIM: 602797
• UniProt ID: Q16777