Recombinant Human HIST2H2AC Protein, GST-tagged

Cat.No. : HIST2H2AC-4809H
Product Overview : Human HIST2H2AC full-length ORF ( NP_003508.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 40.4 kDa
AA Sequence : MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST2H2AC histone cluster 2, H2ac [ Homo sapiens ]
Official Symbol HIST2H2AC
Synonyms H2A; H2A/q; H2AFQ; H2A-GL101
Gene ID 8338
mRNA Refseq NM_003517
Protein Refseq NP_003508
MIM 602797
UniProt ID Q16777

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIST2H2AC Products

Required fields are marked with *

My Review for All HIST2H2AC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon