Recombinant Full Length Human HIF1AN Protein, GST-tagged

Description :	HIF1AN (Hypoxia Inducible Factor 1 Alpha Subunit Inhibitor) is a Protein Coding gene. Diseases associated with HIF1AN include Hypoxia and Anemia Of Prematurity. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Photodynamic therapy-induced HIF-1 survival signaling. GO annotations related to this gene include protein homodimerization activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors. An important paralog of this gene is HSPBAP1.
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	64.13 kDa
Protein length :	349 amino acids
AA Sequence :	MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ]
Official Symbol	HIF1AN
Synonyms	HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase;
Gene ID	55662
mRNA Refseq	NM_017902
Protein Refseq	NP_060372
MIM	606615
UniProt ID	Q9NWT6