Recombinant Full Length Human HIF1AN Protein, C-Flag-tagged
Cat.No. : | HIF1AN-1402HFL |
Product Overview : | Recombinant Full Length Human HIF1AN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLV YPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGG EERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQI KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHH IESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | HIF1AN hypoxia inducible factor 1 subunit alpha inhibitor [ Homo sapiens (human) ] |
Official Symbol | HIF1AN |
Synonyms | FIH1 |
Gene ID | 55662 |
mRNA Refseq | NM_017902.3 |
Protein Refseq | NP_060372.2 |
MIM | 606615 |
UniProt ID | Q9NWT6 |
◆ Recombinant Proteins | ||
HIF1AN-3467HF | Recombinant Full Length Human HIF1AN Protein, GST-tagged | +Inquiry |
HIF1AN-448H | Recombinant Human HIF1AN Protein, His-tagged | +Inquiry |
HIF1AN-29315TH | Recombinant Human HIF1AN | +Inquiry |
HIF1AN-1069H | Recombinant Human HIF1AN Protein, His (Fc)-Avi-tagged | +Inquiry |
HIF1AN-249H | Recombinant Human HIF1AN Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
0
Inquiry Basket