Recombinant Full Length Human HECTD2 Protein, GST-tagged

Cat.No. : HECTD2-3459HF
Product Overview : Human HECTD2 full-length ORF ( NP_775768.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : HECTD2 (HECT Domain E3 Ubiquitin Protein Ligase 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. An important paralog of this gene is UBE3A.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 48.7 kDa
Protein length : 207 amino acids
AA Sequence : MSEAVRVPSPATPLVVAAAAPEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFKKDATASFNTIEDSGINAKFVNAVYDTLLNTVSIMTCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ]
Official Symbol HECTD2
Synonyms HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050;
Gene ID 143279
mRNA Refseq NM_173497
Protein Refseq NP_775768
UniProt ID Q5U5R9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HECTD2 Products

Required fields are marked with *

My Review for All HECTD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon