Recombinant Full Length Human GSK3B Protein, C-Flag-tagged
Cat.No. : | GSK3B-430HFL |
Product Overview : | Recombinant Full Length Human GSK3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ IREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAH SFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ TNNAASASASNSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Alzheimer's disease, Axon guidance, Basal cell carcinoma, B cell receptor signaling pathway, Cell cycle, Chemokine signaling pathway, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Hedgehog signaling pathway, Insulin signaling pathway, Melanogenesis, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, T cell receptor signaling pathway, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens (human) ] |
Official Symbol | GSK3B |
Synonyms | glycogen synthase kinase-3 beta; glycogen synthase kinase 3 beta; GSK3beta isoform |
Gene ID | 2932 |
mRNA Refseq | NM_002093.4 |
Protein Refseq | NP_002084.2 |
MIM | 605004 |
UniProt ID | P49841 |
◆ Recombinant Proteins | ||
GSK3B-2649H | Recombinant Human Glycogen Synthase Kinase 3 Beta, His-tagged | +Inquiry |
GSK3B-120H | Recombinant Human GSK3B Protein, DDK-tagged | +Inquiry |
GSK3B-2858H | Recombinant Human GSK3B (1-351aa), His-tagged | +Inquiry |
Gsk3b-2521M | Active Recombinant Mouse Gsk3b protein, His-tagged | +Inquiry |
GSK3B-735H | Recombinant Human GSK3B | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *
0
Inquiry Basket