Recombinant Full Length Human FBL Protein, C-Flag-tagged
Cat.No. : | FBL-112HFL |
Product Overview : | Recombinant Full Length Human FBL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNR GRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPF RSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNI IPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFA SEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | FBL fibrillarin [ Homo sapiens (human) ] |
Official Symbol | FBL |
Synonyms | FIB; FLRN; Nop1; RNU3IP1 |
Gene ID | 2091 |
mRNA Refseq | NM_001436.4 |
Protein Refseq | NP_001427.2 |
MIM | 134795 |
UniProt ID | P22087 |
◆ Recombinant Proteins | ||
FBL-3869H | Recombinant Human FBL Protein, GST-tagged | +Inquiry |
FBL-12762H | Recombinant Human FBL, His-tagged | +Inquiry |
FBL-85H | Recombinant Human FBL Protein, His-tagged | +Inquiry |
FBL-28104TH | Recombinant Human FBL, His-tagged | +Inquiry |
FBL-1938R | Recombinant Rat FBL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBL-6319HCL | Recombinant Human FBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBL Products
Required fields are marked with *
My Review for All FBL Products
Required fields are marked with *
0
Inquiry Basket