Recombinant Full Length Human FABP2 Protein, GST-tagged

Cat.No. : FABP2-4421HF
Product Overview : Human FABP2 full-length ORF (1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 72 amino acids
Description : The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017]
Molecular Mass : 34.32 kDa
AA Sequence : MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGINSQSKNQALFETLKLFLNLVSPLITT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FABP2 fatty acid binding protein 2, intestinal [ Homo sapiens ]
Official Symbol FABP2
Synonyms FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132;
Gene ID 2169
mRNA Refseq NM_000134
Protein Refseq NP_000125
MIM 134640
UniProt ID P12104

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FABP2 Products

Required fields are marked with *

My Review for All FABP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon