Recombinant Full Length Human EPHA7 Protein

• Cat.No.: EPHA7-154HF
• Product Overview: Recombinant full length Human Eph receptor A7 with an N terminal proprietary tag; Predicted MWt 56.32 kDa.

Specification

• Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 56.320kDa inclusive of tags
• Protein length: 279 amino acids
• AA Sequence: MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKA QQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPN QNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK ETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDL GERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: EPHA7 EPH receptor A7 [ Homo sapiens ]
• Official Symbol: EPHA7
• Synonyms: EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11
• Gene ID: 2045
• mRNA Refseq: NM_004440
• Protein Refseq: NP_004431
• MIM: 602190
• UniProt ID: Q15375