Recombinant Human EPHA7
| Cat.No. : | EPHA7-26442TH |
| Product Overview : | Recombinant full length Human Eph receptor A7 with an N terminal proprietary tag; Predicted MWt 56.32 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. |
| Protein length : | 279 amino acids |
| Molecular Weight : | 56.320kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Widely expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKA QQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPN QNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK ETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDL GERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK |
| Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.Contains 2 fibronectin type-III domains.Contains 1 protein kinase domain.Contains 1 SAM (sterile alpha motif) domain. |
| Tag : | Non |
| Gene Name | EPHA7 EPH receptor A7 [ Homo sapiens ] |
| Official Symbol | EPHA7 |
| Synonyms | EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; |
| Gene ID | 2045 |
| mRNA Refseq | NM_004440 |
| Protein Refseq | NP_004431 |
| MIM | 602190 |
| Uniprot ID | Q15375 |
| Chromosome Location | 6q16.3 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EphrinA-EPHA pathway, organism-specific biosystem; |
| Function | ATP binding; GPI-linked ephrin receptor activity; axon guidance receptor activity; chemorepellent activity; ephrin receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPHA7 Products
Required fields are marked with *
My Review for All EPHA7 Products
Required fields are marked with *
0
Inquiry Basket
