Recombinant Human ELK4

• Cat.No.: ELK4-28290TH
• Product Overview: Recombinant fragment corresponding to amino acids 118-206 of Human ELK4 with an N terminal proprietary tag; predicted mwt: 35.42 kDa inclusive of tag.

Specification

• Description: This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene.
• Protein length: 89 amino acids
• Molecular Weight: 35.420kDa
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA
• Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ]
• Official Symbol: ELK4
• Synonyms: ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1
• Gene ID: 2005
• mRNA Refseq: NM_001973
• Protein Refseq: NP_001964
• MIM: 600246
• Uniprot ID: P28324
• Chromosome Location: 1q32
• Pathway: EGFR1 Signaling Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Id Signaling Pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem
• Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription cofactor activity