Recombinant Human EIF5A2, His-tagged

• Cat.No.: EIF5A2-27178TH
• Product Overview: Recombinant full length Human eIF5A2 with N terminal His tag; 173 amino acids with tag, Predicted MWt 18.9kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 153 amino acids
• Description: Eukaryotic translation initiation factor 5A-2 is a protein that in humans is encoded by the EIF5A2 gene.
• Conjugation: HIS
• Molecular Weight: 18.900kDa inclusive of tags
• Tissue specificity: Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
• Sequence Similarities: Belongs to the eIF-5A family.

Gene Information

• Gene Name: EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ]
• Official Symbol: EIF5A2
• Synonyms: EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2
• Gene ID: 56648
• mRNA Refseq: NM_020390
• Protein Refseq: NP_065123
• MIM: 605782
• Uniprot ID: Q9GZV4
• Chromosome Location: 3q26.2
• Pathway: Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem
• Function: RNA binding; protein binding; ribosome binding; translation elongation factor activity