Recombinant Full Length Human EIF3E Protein, C-Flag-tagged

• Cat.No.: EIF3E-1080HFL
• Product Overview: Recombinant Full Length Human EIF3E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Enables protein N-terminus binding activity. Contributes to translation initiation factor activity. Involved in positive regulation of mRNA binding activity; regulation of gene expression; and translational initiation. Located in cytosol and nucleus. Part of eukaryotic translation initiation factor 3 complex. Colocalizes with PML body.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 52 kDa
• AA Sequence: MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHAL REKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYE CGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAVMEDLTRLKETIDNNSVSSPLQSLQQ RTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
  NIEKKLNQNSRSEAPNWATQDSGFYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: EIF3E eukaryotic translation initiation factor 3 subunit E [ Homo sapiens (human) ]
• Official Symbol: EIF3E
• Synonyms: INT6; EIF3S6; EIF3-P48; eIF3-p46
• Gene ID: 3646
• mRNA Refseq: NM_001568.3
• Protein Refseq: NP_001559.1
• MIM: 602210
• UniProt ID: P60228