Recombinant Full Length Human EIF3E Protein, GST-tagged
Cat.No. : | EIF3E-4247HF |
Product Overview : | Human EIF3S6 full-length ORF ( NP_001559.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 445 amino acids |
Description : | EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity. |
Molecular Mass : | 78.6 kDa |
AA Sequence : | MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ] |
Official Symbol | EIF3E |
Synonyms | EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; eIF-3 p48; mammary tumor-associated protein INT6; viral integration site protein INT-6 homolog; eukaryotic translation initiation factor 3 subunit 6; murine mammary tumor integration site 6 (oncogene homolog); eukaryotic translation initiation factor 3, subunit 6 48kDa; eukaryotic translation initiation factor 3, subunit 6 (48kD); INT6; EIF3S6; EIF3-P48; eIF3-p46; |
Gene ID | 3646 |
mRNA Refseq | NM_001568 |
Protein Refseq | NP_001559 |
MIM | 602210 |
UniProt ID | P60228 |
◆ Recombinant Proteins | ||
EIF3E-823H | Recombinant Human EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3E-1246R | Recombinant Rhesus Macaque EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3E-4247HF | Recombinant Full Length Human EIF3E Protein, GST-tagged | +Inquiry |
EIF3E-3596H | Recombinant Human EIF3E protein, His-tagged | +Inquiry |
EIF3E-2043H | Recombinant Human EIF3E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3E Products
Required fields are marked with *
My Review for All EIF3E Products
Required fields are marked with *
0
Inquiry Basket