Recombinant Full Length Human EDA2R Protein, GST-tagged

• Cat.No.: EDA2R-4177HF
• Product Overview: Human EDA2R full-length ORF ( NP_068555.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 297 amino acids
• Description: The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin, which plays an important role in maintenance of hair and teeth. Alternatively spliced transcript variants encodes distinct protein isoforms. [provided by RefSeq, Apr 2016]
• Molecular Mass: 59.1 kDa
• AA Sequence: MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDA2R ectodysplasin A2 receptor [ Homo sapiens ]
• Official Symbol: EDA2R
• Synonyms: EDA2R; ectodysplasin A2 receptor; tumor necrosis factor receptor superfamily member 27; EDA A2R; EDAA2R; TNFRSF27; XEDAR; EDA-A2 receptor; X-linked ectodysplasin-A2 receptor; tumor necrosis factor receptor superfamily member XEDAR; EDA-A2R
• Gene ID: 60401
• mRNA Refseq: NM_001199687
• Protein Refseq: NP_001186616
• MIM: 300276
• UniProt ID: Q9HAV5