Recombinant Full Length Human DNAJC3 Protein, GST-tagged

• Cat.No.: DNAJC3-4016HF
• Product Overview: Human DNAJC3 full-length ORF ( AAH33823, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). [provided by RefSeq, Jul 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.48 kDa
• Protein length: 234 amino acids
• AA Sequence: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
• Official Symbol: DNAJC3
• Synonyms: DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK; protein kinase inhibitor p58; protein kinase inhibitor of 58 kDa; interferon-induced, double-stranded RNA-activated protein kinase inhibitor; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor; FLJ21288
• Gene ID: 5611
• mRNA Refseq: NM_006260
• Protein Refseq: NP_006251
• MIM: 601184
• UniProt ID: Q13217