Recombinant Full Length Human DNAJC3 Protein
Cat.No. : | DNAJC3-124HF |
Product Overview : | Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 234 amino acids |
Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). |
Form : | Liquid |
Molecular Mass : | 51.850kDa inclusive of tags |
AA Sequence : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ] |
Official Symbol | DNAJC3 |
Synonyms | DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK |
Gene ID | 5611 |
mRNA Refseq | NM_006260 |
Protein Refseq | NP_006251 |
MIM | 601184 |
UniProt ID | Q13217 |
◆ Recombinant Proteins | ||
DNAJC3-1571R | Recombinant Rat DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-3799H | Recombinant Human DNAJC3 protein, His-tagged | +Inquiry |
DNAJC3-564H | Recombinant Human DNAJC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dnajc3-006M | Recombinant Mouse Dnajc3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-2760H | Recombinant Human DNAJC3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC3 Products
Required fields are marked with *
My Review for All DNAJC3 Products
Required fields are marked with *
0
Inquiry Basket