Recombinant Full Length Human DNAJC3 Protein

Cat.No. : DNAJC3-124HF
Product Overview : Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 51.850kDa inclusive of tags
Protein length : 234 amino acids
AA Sequence : MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
Official Symbol DNAJC3
Synonyms DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK
Gene ID 5611
mRNA Refseq NM_006260
Protein Refseq NP_006251
MIM 601184
UniProt ID Q13217

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAJC3 Products

Required fields are marked with *

My Review for All DNAJC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon