Recombinant Full Length Human CXCR6 Protein
Cat.No. : | CXCR6-2326HF |
Product Overview : | Human CXCR6 full-length ORF (NP_006555.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 342 amino acids |
Description : | CXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CXCR6 include Xanthogranulomatous Cholecystitis. Among its related pathways are Peptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include G-protein coupled receptor activity and C-X-C chemokine receptor activity. An important paralog of this gene is CCR6. |
Form : | Liquid |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] |
Official Symbol | CXCR6 |
Synonyms | CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; |
Gene ID | 10663 |
mRNA Refseq | NM_006564 |
Protein Refseq | NP_006555 |
MIM | 605163 |
UniProt ID | O00574 |
◆ Cell & Tissue Lysates | ||
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCR6 Products
Required fields are marked with *
My Review for All CXCR6 Products
Required fields are marked with *
0
Inquiry Basket