Recombinant Human CXCR6 Protein

• Cat.No.: CXCR6-2183H
• Product Overview: Human CXCR6 full-length ORF (NP_006555.1) recombinant protein without tag.

Specification

• Description: CXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CXCR6 include Xanthogranulomatous Cholecystitis. Among its related pathways are Peptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include G-protein coupled receptor activity and C-X-C chemokine receptor activity. An important paralog of this gene is CCR6.
• Source: Wheat Germ
• Species: Human
• Form: Liquid
• Molecular Mass: 39.3 kDa
• AA Sequence: MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ]
• Official Symbol: CXCR6
• Synonyms: CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33
• Gene ID: 10663
• mRNA Refseq: NM_006564
• Protein Refseq: NP_006555
• MIM: 605163
• UniProt ID: O00574