Recombinant Human CXCR6 protein, GST-tagged

• Cat.No.: CXCR6-301461H
• Product Overview: Recombinant Human CXCR6 (1-32 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Val32
• AA Sequence: MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ]
• Official Symbol: CXCR6
• Synonyms: CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33
• Gene ID: 10663
• mRNA Refseq: NM_006564
• Protein Refseq: NP_006555
• MIM: 605163
• UniProt ID: O00574