Recombinant Human CXCR6 protein, GST-tagged
Cat.No. : | CXCR6-301461H |
Product Overview : | Recombinant Human CXCR6 (1-32 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val32 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] |
Official Symbol | CXCR6 |
Synonyms | CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; |
Gene ID | 10663 |
mRNA Refseq | NM_006564 |
Protein Refseq | NP_006555 |
MIM | 605163 |
UniProt ID | O00574 |
◆ Cell & Tissue Lysates | ||
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCR6 Products
Required fields are marked with *
My Review for All CXCR6 Products
Required fields are marked with *
0
Inquiry Basket