Recombinant Full Length Human CXCL1 Protein, GST-tagged

• Cat.No.: CXCL1-2225HF
• Product Overview: Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 107 amino acids
• Description: This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
• Molecular Mass: 37.51 kDa
• AA Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ]
• Official Symbol: CXCL1
• Synonyms: CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein , FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha) , MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a
• Gene ID: 2919
• mRNA Refseq: NM_001511
• Protein Refseq: NP_001502
• MIM: 155730
• UniProt ID: P09341