Recombinant Human CXCL1, StrepII-tagged

• Cat.No.: CXCL1-281H
• Product Overview: Purified, full-length human recombinant GRO-alpha (CXCL1) protein (amino acids 35-107, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.3 kDa. (Accession NP_001502.1; UniProt P09341)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 35-107, 73 a.a.
• Description: GRO-alpha is a member of the CXC subfamily of chemokines. It is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVI ATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ]
• Official Symbol: CXCL1
• Synonyms: CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein , FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha) , MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a
• Gene ID: 2919
• mRNA Refseq: NM_001511
• Protein Refseq: NP_001502
• MIM: 155730
• UniProt ID: P09341
• Chromosome Location: 4q13.3
• Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem
• Function: chemokine activity; enzyme activator activity; growth factor activity; receptor binding