Recombinant Full Length Human CX3CR1 Protein, GST-tagged
Cat.No. : | CX3CR1-2222HF |
Product Overview : | Human CX3CR1 full-length ORF ( AAH28078.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 355 amino acids |
Description : | Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 64.79 kDa |
AA Sequence : | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ] |
Official Symbol | CX3CR1 |
Synonyms | CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28; CMK-BRL1; CMK-BRL-1; C-X3-C CKR-1; fractalkine receptor; G protein-coupled receptor 13; G-protein coupled receptor 13; chemokine (C-X3-C) receptor 1; beta chemokine receptor-like 1; chemokine (C-C) receptor-like 1; GPR13; GPRV28; CMKBRL1 |
Gene ID | 1524 |
mRNA Refseq | NM_001171171 |
Protein Refseq | NP_001164642 |
MIM | 601470 |
UniProt ID | P49238 |
◆ Recombinant Proteins | ||
CX3CR1-220H | Recombinant Human CX3CR1 Protein, His/GST-tagged | +Inquiry |
RFL26864OF | Recombinant Full Length Rabbit Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
RFL20493HF | Recombinant Full Length Human Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
CX3CR1-1103R | Recombinant Rhesus monkey CX3CR1 Protein, His-tagged | +Inquiry |
CX3CR1-103HF | Recombinant Full Length Human CX3CR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CX3CR1 Products
Required fields are marked with *
My Review for All CX3CR1 Products
Required fields are marked with *
0
Inquiry Basket