Recombinant Full Length Human CTSE Protein
Cat.No. : | CTSE-104HF |
Product Overview : | Recombinant full length mature Human Cathepsin E, isoform 1 with N terminal propretary tag, 67.8kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 379 amino acids |
Description : | The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene. |
Form : | Liquid |
Molecular Mass : | 67.800kDa inclusive of tags |
AA Sequence : | QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFT ESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDT GSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSI QYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLV DAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSV YMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQ IALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQL QNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPT AYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQ FYSVFDRGNNRVGLAPAVP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CTSE cathepsin E [ Homo sapiens ] |
Official Symbol | CTSE |
Synonyms | CTSE; cathepsin E |
Gene ID | 1510 |
mRNA Refseq | NM_001910 |
Protein Refseq | NP_001901 |
MIM | 116890 |
UniProt ID | P14091 |
◆ Recombinant Proteins | ||
CTSE-104HF | Recombinant Full Length Human CTSE Protein | +Inquiry |
CTSE-2104H | Recombinant Human CTSE Protein, GST-tagged | +Inquiry |
Ctse-5637M | Recombinant Mouse Ctse Protein (Ser60-Pro397), C-His tagged | +Inquiry |
Ctse-749M | Recombinant Mouse Cathepsin E, His-tagged | +Inquiry |
CTSE-11685H | Recombinant Human CTSE, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSE-2190MCL | Recombinant Mouse CTSE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSE Products
Required fields are marked with *
My Review for All CTSE Products
Required fields are marked with *
0
Inquiry Basket