Recombinant Full Length Human CTAG1A Protein, C-Flag-tagged
Cat.No. : | CTAG1A-152HFL |
Product Overview : | Recombinant Full Length Human CTAG1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
Official Symbol | CTAG1A |
Synonyms | ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1 |
Gene ID | 246100 |
mRNA Refseq | NM_139250.2 |
Protein Refseq | NP_640343.1 |
MIM | 300657 |
UniProt ID | P78358 |
◆ Recombinant Proteins | ||
CTAG1A-5004H | Recombinant Human CTAG1A protein, hFc-Myc-tagged | +Inquiry |
CTAG1A-1371H | Recombinant Human CTAG1A Protein (1-180 aa), His-tagged | +Inquiry |
CTAG1A-2048H | Recombinant Human CTAG1A Protein, GST-tagged | +Inquiry |
CTAG1A-2072H | Recombinant Human CTAG1A Protein (Met1-Arg180), N-SUMO tagged | +Inquiry |
CTAG1A-4933H | Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *
0
Inquiry Basket