Recombinant Human CTAG1A Protein, GST-tagged

• Cat.No.: CTAG1A-2048H
• Product Overview: Human CTAG1A full-length ORF ( AAI60040.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.2 kDa
• AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
• Official Symbol: CTAG1A
• Synonyms: CTAG1A; cancer/testis antigen 1A; Cancer/Testis Antigen 1A; Autoimmunogenic Cancer/Testis Antigen NY-ESO-1; Cancer/Testis Antigen 6.1; L Antigen Family Member 2; LAGE-2; LAGE2A; CT6.1; ESO1; New York Esophageal Squamous Cell Carcinoma 1; Cancer/Testis Antigen 1-A; Cancer/Testis Antigen 1; CTAG1A CTAG1B; NY-ESO-1; LAGE2B; CTAG1; LAGE2; CTAG; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2
• Gene ID: 246100
• mRNA Refseq: NM_139250
• Protein Refseq: NP_640343
• MIM: 300657
• UniProt ID: P78358