Recombinant Human CTAG1A Protein (1-180 aa), His-tagged

Cat.No. : CTAG1A-1371H
Product Overview : Recombinant Human CTAG1A Protein (1-180 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-180 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.0 kDa
AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
Official Symbol CTAG1A
Synonyms ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1;
Gene ID 246100
mRNA Refseq NM_139250
Protein Refseq NP_640343
UniProt ID P78358

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTAG1A Products

Required fields are marked with *

My Review for All CTAG1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon