Recombinant Human CTAG1A Protein (1-180 aa), His-tagged

• Cat.No.: CTAG1A-1371H
• Product Overview: Recombinant Human CTAG1A Protein (1-180 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-180 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.0 kDa
• AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
• Official Symbol: CTAG1A
• Synonyms: ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1
• Gene ID: 246100
• mRNA Refseq: NM_139250
• Protein Refseq: NP_640343
• UniProt ID: P78358