Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CTAG1A-4933H
• Product Overview: CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18 kDa
• AA Sequence: MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
• Official Symbol: CTAG1A
• Synonyms: CTAG1A; cancer/testis antigen 1A; ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2
• Gene ID: 246100
• mRNA Refseq: NM_139250
• Protein Refseq: NP_640343
• MIM: 300657
• UniProt ID: P78358