Recombinant Full Length Human CSTPP1 Protein, GST-tagged

• Cat.No.: CSTPP1-1823HF
• Product Overview: Human CSTPP1 full-length ORF ( NP_001003677.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 337 amino acids
• Description: CSTPP1 (Centriolar Satellite-Associated Tubulin Polyglutamylase Complex Regulator 1) is a Protein Coding gene. Diseases associated with CSTPP1 include Mitochondrial Complex Iii Deficiency and Cole-Carpenter Syndrome.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 64.5 kDa
• AA Sequence: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLLPFFRLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSTPP1 centriolar satellite-associated tubulin polyglutamylase complex regulator 1 [ Homo sapiens (human) ]
• Official Symbol: CSTPP1
• Synonyms: C11orf49
• Gene ID: 79096
• mRNA Refseq: NM_024113.3
• Protein Refseq: NP_077018.1
• UniProt ID: Q9H6J7