Recombinant Full Length Human CSE1L Protein, C-Flag-tagged
Cat.No. : | CSE1L-212HFL |
Product Overview : | Recombinant Full Length Human CSE1L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 110.2 kDa |
AA Sequence : | MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYI KRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQS GDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHANDASALRILFS SLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQ KYDEEFQRYLPRFVTAIWNLLVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVP NMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMI FRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLFTAAEIAPFVEILLTNLFKA LTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITC KANPAAVVNFEEALFLVFTEILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGN IPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQI FILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAG KKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CSE1L chromosome segregation 1 like [ Homo sapiens (human) ] |
Official Symbol | CSE1L |
Synonyms | CAS; CSE1; XPO2 |
Gene ID | 1434 |
mRNA Refseq | NM_001316.4 |
Protein Refseq | NP_001307.2 |
MIM | 601342 |
UniProt ID | P55060 |
◆ Recombinant Proteins | ||
GNAT2-9373Z | Recombinant Zebrafish GNAT2 | +Inquiry |
CCL19A.1-5280Z | Recombinant Zebrafish CCL19A.1 | +Inquiry |
CDK1-998H | Recombinant Human Cyclin-Dependent Kinase 1, GST-tagged | +Inquiry |
TCEA3-1098H | Recombinant Human TCEA3 protein, His & T7-tagged | +Inquiry |
CCNA2-0648H | Recombinant Human CCNA2 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf70-8247HCL | Recombinant Human C16orf70 293 Cell Lysate | +Inquiry |
CSNK1D-7241HCL | Recombinant Human CSNK1D 293 Cell Lysate | +Inquiry |
ANTXR1-1463HCL | Recombinant Human ANTXR1 cell lysate | +Inquiry |
S100A14-2092HCL | Recombinant Human S100A14 293 Cell Lysate | +Inquiry |
CNTN6-7391HCL | Recombinant Human CNTN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSE1L Products
Required fields are marked with *
My Review for All CSE1L Products
Required fields are marked with *
0
Inquiry Basket