Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL33363BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P59711) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTTNPRNYSYMDLNPALCGSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN TPDVPICVYDPLPIILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P59711 |
◆ Recombinant Proteins | ||
CD4-8919HFL | Recombinant Full Length Human CD4 protein, Flag-tagged | +Inquiry |
CYTL1-0382H | Recombinant Human CYTL1 protein, His&Myc-tagged | +Inquiry |
MSP1-67P | Recombinant Pf MSP1 Protein | +Inquiry |
LGALSL-1510H | Recombinant Human LGALSL | +Inquiry |
PCK1-7022HF | Recombinant Full Length Human PCK1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCB5-9152HCL | Recombinant Human ABCB5 293 Cell Lysate | +Inquiry |
LGALS9C-4760HCL | Recombinant Human LGALS9C 293 Cell Lysate | +Inquiry |
THYN1-1081HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
FBLN1-598HCL | Recombinant Human FBLN1 cell lysate | +Inquiry |
ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket