Recombinant Full Length Human CLEC4D Protein, GST-tagged

• Cat.No.: CLEC4D-2159HF
• Product Overview: Human CLEC4D full-length ORF ( AAH32313, 41 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.99 kDa
• Protein length: 215 amino acids
• AA Sequence: VTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ]
• Official Symbol: CLEC4D
• Synonyms: CLEC4D; C-type lectin domain family 4, member D; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 8 , CLECSF8; C-type lectin domain family 4 member D; Mpcl; C-type lectin receptor; macrophage C-type lectin; C-type lectin-like receptor 6; C-type lectin superfamily member 8; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078
• Gene ID: 338339
• mRNA Refseq: NM_080387
• Protein Refseq: NP_525126
• MIM: 609964
• UniProt ID: Q8WXI8