Recombinant Human CLEC4D Protein (39-215 aa), His-SUMO-tagged

• Cat.No.: CLEC4D-1083H
• Product Overview: Recombinant Human CLEC4D Protein (39-215 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 39-215 aa
• Description: Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 36.7 kDa
• AA Sequence: CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ]
• Official Symbol: CLEC4D
• Synonyms: CLEC4D; Mpcl; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078
• Gene ID: 338339
• mRNA Refseq: NM_080387
• Protein Refseq: NP_525126
• MIM: 609964
• UniProt ID: Q8WXI8