Recombinant Full Length Human CLDN4 Protein, GST-tagged
Cat.No. : | CLDN4-2058HF |
Product Overview : | Human CLDN4 full-length ORF ( AAH00671, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 209 amino acids |
Description : | The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 48.73 kDa |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol | CLDN4 |
Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R |
Gene ID | 1364 |
mRNA Refseq | NM_001305 |
Protein Refseq | NP_001296 |
MIM | 602909 |
UniProt ID | O14493 |
◆ Recombinant Proteins | ||
CLDN4-87HF | Recombinant Full Length Human CLDN4 Protein | +Inquiry |
RFL15864MF | Recombinant Full Length Mouse Claudin-4(Cldn4) Protein, His-Tagged | +Inquiry |
CLDN4-26708TH | Recombinant Human CLDN4 | +Inquiry |
Cldn4-901M | Recombinant Mouse Cldn4 Protein, MYC/DDK-tagged | +Inquiry |
CLDN4-722R | Recombinant Rhesus Macaque CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
0
Inquiry Basket