Recombinant Full Length Human CLDN4 Protein

• Cat.No.: CLDN4-87HF
• Product Overview: Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 209 amino acids
• Description: This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
• Form: Liquid
• Molecular Mass: 48.730kDa inclusive of tags
• AA Sequence: MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CLDN4 claudin 4 [ Homo sapiens ]
• Official Symbol: CLDN4
• Synonyms: CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein
• Gene ID: 1364
• mRNA Refseq: NM_001305
• Protein Refseq: NP_001296
• MIM: 602909
• UniProt ID: O14493