Recombinant Full Length Human CLDN4 Protein
Cat.No. : | CLDN4-87HF |
Product Overview : | Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 209 amino acids |
Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Form : | Liquid |
Molecular Mass : | 48.730kDa inclusive of tags |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol | CLDN4 |
Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein |
Gene ID | 1364 |
mRNA Refseq | NM_001305 |
Protein Refseq | NP_001296 |
MIM | 602909 |
UniProt ID | O14493 |
◆ Recombinant Proteins | ||
CLDN4-87HF | Recombinant Full Length Human CLDN4 Protein | +Inquiry |
CLDN4-26708TH | Recombinant Human CLDN4 | +Inquiry |
CLDN4-2058HF | Recombinant Full Length Human CLDN4 Protein, GST-tagged | +Inquiry |
CLDN4-896R | Recombinant Rhesus monkey CLDN4 Protein, His-tagged | +Inquiry |
CLDN4-256H | Active Recombinant Human CLDN4 protein, His-Twin-Strep-tagged(Detergent) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
0
Inquiry Basket