Recombinant Full Length Human CLCF1 Protein, GST-tagged

Cat.No. : CLCF1-1964HF
Product Overview : Human CLCF1 full-length ORF ( AAH12939, 29 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 47.41 kDa
Protein length : 225 amino acids
AA Sequence : NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLCF1 cardiotrophin-like cytokine factor 1 [ Homo sapiens ]
Official Symbol CLCF1
Synonyms CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6; novel neurotrophin-1; B-cell stimulating factor 3; B-cell stimulatory factor 3; B-cell-stimulating factor 3; CRLF1 associated cytokine-like factor 1; neurotrophin-1/B-cell stimulating factor-3; BSF-3; NNT-1
Gene ID 23529
mRNA Refseq NM_001166212
Protein Refseq NP_001159684
MIM 607672
UniProt ID Q9UBD9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLCF1 Products

Required fields are marked with *

My Review for All CLCF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon