Recombinant Full Length Human CIDEA Protein, GST-tagged
Cat.No. : | CIDEA-1848HF |
Product Overview : | Human CIDEA full-length ORF ( AAH31896, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 253 amino acids |
Description : | This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified. [provided by RefSeq, Aug 2010] |
Molecular Mass : | 53.57 kDa |
AA Sequence : | MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIDEA cell death-inducing DFFA-like effector a [ Homo sapiens ] |
Official Symbol | CIDEA |
Synonyms | CIDEA; cell death-inducing DFFA-like effector a; cell death activator CIDE-A; CIDE A; CIDE-A |
Gene ID | 1149 |
mRNA Refseq | NM_001279 |
Protein Refseq | NP_001270 |
MIM | 604440 |
UniProt ID | O60543 |
◆ Recombinant Proteins | ||
CIDEA-1690M | Recombinant Mouse CIDEA Protein, His (Fc)-Avi-tagged | +Inquiry |
CIDEA-1834H | Recombinant Full Length Human CIDEA protein, His & GST-tagged | +Inquiry |
CIDEA-1848HF | Recombinant Full Length Human CIDEA Protein, GST-tagged | +Inquiry |
CIDEA-1361H | Recombinant Human CIDEA Protein, GST-tagged | +Inquiry |
CIDEA-3471M | Recombinant Mouse CIDEA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIDEA-358HCL | Recombinant Human CIDEA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIDEA Products
Required fields are marked with *
My Review for All CIDEA Products
Required fields are marked with *
0
Inquiry Basket