Recombinant Full Length Human CDRT4 Protein, GST-tagged

Cat.No. : CDRT4-3250HF
Product Overview : Human CDRT4 full-length ORF (BAC04263.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 152 amino acids
Description : CDRT4 (CMT1A Duplicated Region Transcript 4) is a Protein Coding gene. GO annotations related to this gene include DNA-directed 5-3 RNA polymerase activity.
Molecular Mass : 44 kDa
AA Sequence : MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDRT4 CMT1A duplicated region transcript 4 [ Homo sapiens ]
Official Symbol CDRT4
Synonyms CDRT4; CMT1A duplicated region transcript 4; CMT1A duplicated region transcript 4 protein; FLJ36674; MGC33988;
Gene ID 284040
mRNA Refseq NM_001204477
Protein Refseq NP_001191406
UniProt ID Q8N9R6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDRT4 Products

Required fields are marked with *

My Review for All CDRT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon