Recombinant Full Length Human CDRT4 Protein, GST-tagged

• Cat.No.: CDRT4-3250HF
• Product Overview: Human CDRT4 full-length ORF (BAC04263.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 152 amino acids
• Description: CDRT4 (CMT1A Duplicated Region Transcript 4) is a Protein Coding gene. GO annotations related to this gene include DNA-directed 5-3 RNA polymerase activity.
• Molecular Mass: 44 kDa
• AA Sequence: MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDRT4 CMT1A duplicated region transcript 4 [ Homo sapiens ]
• Official Symbol: CDRT4
• Synonyms: CDRT4; CMT1A duplicated region transcript 4; CMT1A duplicated region transcript 4 protein; FLJ36674; MGC33988
• Gene ID: 284040
• mRNA Refseq: NM_001204477
• Protein Refseq: NP_001191406
• UniProt ID: Q8N9R6