Recombinant Full Length Escherichia Coli Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL20231EF |
Product Overview : | Recombinant Full Length Escherichia coli Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q1R3C4) (20-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-565) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNEASQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFIMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGET HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; UTI89_C4733; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q1R3C4 |
◆ Native Proteins | ||
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
C1-95H | Active Native Human C1 Complex | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN2-533MCL | Recombinant Mouse PTPN2 cell lysate | +Inquiry |
LPAR1-4675HCL | Recombinant Human LPAR1 293 Cell Lysate | +Inquiry |
THOC7-1091HCL | Recombinant Human THOC7 293 Cell Lysate | +Inquiry |
C6orf48-7981HCL | Recombinant Human C6orf48 293 Cell Lysate | +Inquiry |
TGIF1-1116HCL | Recombinant Human TGIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket