Recombinant Full Length Human CDC42EP2 Protein, GST-tagged
Cat.No. : | CDC42EP2-3103HF |
Product Overview : | Human CDC42EP2 full-length ORF (NP_006770.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 210 amino acids |
Description : | CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC42EP2 CDC42 effector protein (Rho GTPase binding) 2 [ Homo sapiens ] |
Official Symbol | CDC42EP2 |
Synonyms | CDC42EP2; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; BORG1; CEP2; CRIB containing BOGR1 protein; binder of Rho GTPases 1; CRIB-containing BOGR1 protein; |
Gene ID | 10435 |
mRNA Refseq | NM_006779 |
Protein Refseq | NP_006770 |
MIM | 606132 |
UniProt ID | O14613 |
◆ Recombinant Proteins | ||
CDC42EP2-3144M | Recombinant Mouse CDC42EP2 Protein | +Inquiry |
CDC42EP2-939R | Recombinant Rat CDC42EP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42EP2-0945H | Recombinant Human CDC42EP2 Protein, GST-Tagged | +Inquiry |
Cdc42ep2-254M | Recombinant Mouse Cdc42ep2 Protein, MYC/DDK-tagged | +Inquiry |
CDC42EP2-3103HF | Recombinant Full Length Human CDC42EP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42EP2-7653HCL | Recombinant Human CDC42EP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC42EP2 Products
Required fields are marked with *
My Review for All CDC42EP2 Products
Required fields are marked with *
0
Inquiry Basket