Recombinant Human CDC42EP2 Protein, GST-Tagged

Cat.No. : CDC42EP2-0945H
Product Overview : Human CDC42EP2 full-length ORF (NP_006770.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011]
Molecular Mass : 48.9 kDa
AA Sequence : MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC42EP2 CDC42 effector protein (Rho GTPase binding) 2 [ Homo sapiens ]
Official Symbol CDC42EP2
Synonyms CDC42EP2; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; BORG1; CEP2; CRIB containing BOGR1 protein; binder of Rho GTPases 1; CRIB-containing BOGR1 protein;
Gene ID 10435
mRNA Refseq NM_006779
Protein Refseq NP_006770
MIM 606132
UniProt ID O14613

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDC42EP2 Products

Required fields are marked with *

My Review for All CDC42EP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon