Recombinant Full Length Human C10orf53 Protein, GST-tagged
| Cat.No. : | C10orf53-1702HF |
| Product Overview : | Human C10orf53 full-length ORF ( AAH28127.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | C10orf53 (Chromosome 10 Open Reading Frame 53) is a Protein Coding gene. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44 kDa |
| Protein length : | 157 amino acids |
| AA Sequence : | MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEFGKLTPSSDKRTTSSSRLTFHQLSSPCGMKVSPLQQFPQKTQDLTCIVLAQIGSCIHFQTNLCDLGWPGLDHMLISGLEKRGTQPY |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf53 chromosome 10 open reading frame 53 [ Homo sapiens ] |
| Official Symbol | C10orf53 |
| Synonyms | C10orf53 |
| Gene ID | 282966 |
| mRNA Refseq | NM_182554.2 |
| Protein Refseq | NP_872360.2 |
| UniProt ID | Q8N6V4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf53 Products
Required fields are marked with *
My Review for All C10orf53 Products
Required fields are marked with *
0
Inquiry Basket
