Recombinant Human C10orf53 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C10orf53-877H
• Product Overview: C10orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001035892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: C10orf53 (Chromosome 10 Open Reading Frame 53) is a Protein Coding gene. Diseases associated with C10orf53 include Uterine Corpus Endometrial Carcinoma.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.2 kDa
• AA Sequence: MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEFGGDGKLDPLCEKARIAVLNAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C10orf53 chromosome 10 open reading frame 53 [ Homo sapiens (human) ]
• Official Symbol: C10orf53
• Synonyms: C10orf53; chromosome 10 open reading frame 53; FLJ60598; UPF0728 protein C10orf53
• Gene ID: 282966
• mRNA Refseq: NM_001042427
• Protein Refseq: NP_001035892
• UniProt ID: Q8N6V4