Recombinant Full Length Human BCAT2 Protein, C-Flag-tagged
Cat.No. : | BCAT2-575HFL |
Product Overview : | Recombinant Full Length Human BCAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | BCAT2 branched chain amino acid transaminase 2 [ Homo sapiens (human) ] |
Official Symbol | BCAT2 |
Synonyms | BCAM; BCT2; HVLI; PP18; BCATM |
Gene ID | 587 |
mRNA Refseq | NM_001190.4 |
Protein Refseq | NP_001181.2 |
MIM | 113530 |
UniProt ID | O15382 |
◆ Recombinant Proteins | ||
BCAT2-15863H | Recombinant Human BCAT2, His-tagged | +Inquiry |
BCAT2-952R | Recombinant Rat BCAT2 Protein | +Inquiry |
BCAT2-433H | Recombinant Human BCAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAT2-0247H | Recombinant Human BCAT2 Protein (A28-V392), His/Strep tagged | +Inquiry |
BCAT2-575HFL | Recombinant Full Length Human BCAT2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAT2-162HCL | Recombinant Human BCAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAT2 Products
Required fields are marked with *
My Review for All BCAT2 Products
Required fields are marked with *
0
Inquiry Basket