Recombinant Full Length Human BAIAP2L2 Protein, GST-tagged

• Cat.No.: BAIAP2L2-1808HF
• Product Overview: Human BAIAP2L2 full-length ORF ( AAH15619.1, 1 a.a. - 518 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene binds phosphoinositides and promotes the formation of planar or curved membrane structures. The encoded protein is found in RAB13-positive vesicles and at intercellular contacts with the plasma membrane.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 84.1 kDa
• Protein length: 518 amino acids
• AA Sequence: MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAIAP2L2 BAI1-associated protein 2-like 2 [ Homo sapiens ]
• Official Symbol: BAIAP2L2
• Synonyms: BAIAP2L2; BAI1-associated protein 2-like 2; brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2; FLJ22582; pinkbar; BAI1-associated protein 2-like protein 2; planar intestinal- and kidney-specific BAR domain protein
• Gene ID: 80115
• mRNA Refseq: NM_025045
• Protein Refseq: NP_079321
• MIM: 617536
• UniProt ID: Q6UXY1