Recombinant Human BAIAP2L2 protein, GST-tagged

Cat.No. : BAIAP2L2-065H
Product Overview : Human BAIAP2L2 full-length ORF ( AAH15619.1, 1 a.a. - 518 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 84.1 kDa
AA Sequence : MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAIAP2L2 BAI1-associated protein 2-like 2 [ Homo sapiens ]
Official Symbol BAIAP2L2
Synonyms BAIAP2L2; BAI1-associated protein 2-like 2; brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2; FLJ22582; pinkbar; BAI1-associated protein 2-like protein 2; planar intestinal- and kidney-specific BAR domain protein;
Gene ID 80115
mRNA Refseq NM_025045
Protein Refseq NP_079321
UniProt ID Q6UXY1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BAIAP2L2 Products

Required fields are marked with *

My Review for All BAIAP2L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon