Recombinant Full Length Human BAD Protein, GST-tagged
Cat.No. : | BAD-1767HF |
Product Overview : | Human BAD full-length ORF ( AAH01901.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 168 amino acids |
Description : | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.11 kDa |
AA Sequence : | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAD BCL2-associated agonist of cell death [ Homo sapiens ] |
Official Symbol | BAD |
Synonyms | BAD; BCL2-associated agonist of cell death; bcl2 antagonist of cell death; BBC2; BCL2L8; bcl2-L-8; BCL2-binding protein; bcl-2-like protein 8; BCL2-binding component 6; bcl-2-binding component 6; BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death protein; bcl-XL/Bcl-2-associated death promoter |
Gene ID | 572 |
mRNA Refseq | NM_004322 |
Protein Refseq | NP_004313 |
MIM | 603167 |
UniProt ID | Q92934 |
◆ Recombinant Proteins | ||
BAD-505R | Recombinant Rhesus monkey BAD Protein, His-tagged | +Inquiry |
BAD-82H | Recombinant Human BCL2-associated Agonist Of Cell Death | +Inquiry |
BAD-949M | Recombinant Mouse BAD Protein, His (Fc)-Avi-tagged | +Inquiry |
BAD-168H | Recombinant Human v protein, His-tagged | +Inquiry |
BAD-6973H | Recombinant Human BAD, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAD Products
Required fields are marked with *
My Review for All BAD Products
Required fields are marked with *
0
Inquiry Basket