Recombinant Full Length Human ASCL1 Protein, C-Flag-tagged
Cat.No. : | ASCL1-754HFL |
Product Overview : | Recombinant Full Length Human ASCL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS SYSSDEGSYDPLSPEEQELLDFTNWFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | ASCL1 achaete-scute family bHLH transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | ASCL1 |
Synonyms | ASH1; HASH1; MASH1; bHLHa46 |
Gene ID | 429 |
mRNA Refseq | NM_004316.4 |
Protein Refseq | NP_004307.2 |
MIM | 100790 |
UniProt ID | P50553 |
◆ Recombinant Proteins | ||
ASCL1-386H | Recombinant Human ASCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASCL1-131H | Recombinant Human ASCL1 protein, Arginine-tagged | +Inquiry |
ASCL1-28522TH | Recombinant Human ASCL1 | +Inquiry |
ASCL1-754HFL | Recombinant Full Length Human ASCL1 Protein, C-Flag-tagged | +Inquiry |
ASCL1-818R | Recombinant Rat ASCL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASCL1-8654HCL | Recombinant Human ASCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASCL1 Products
Required fields are marked with *
My Review for All ASCL1 Products
Required fields are marked with *
0
Inquiry Basket