Recombinant Human ASCL1 protein, Arginine-tagged

• Cat.No.: ASCL1-131H
• Product Overview: Recombinant human ASCL1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: Arginine
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: ESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSG GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAAN KKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEE QELLDFTNWFLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for neuronal cell trans-differentiation in vitro.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days

Gene Information

• Gene Name: ASCL1 achaete-scute complex homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: ASCL1
• Synonyms: ASCL1; achaete-scute homolog 1; ASH1; bHLHa46; HASH1; ASH-1; achaete scute protein; achaete-scute complex-like 1; class A basic helix-loop-helix protein 46; MASH1
• Gene ID: 429
• mRNA Refseq: NM_004316
• Protein Refseq: NP_004307
• MIM: 100790
• UniProt ID: P50553
• Chromosome Location: 12q22-q23
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem
• Function: DNA binding; E-box binding; bHLH transcription factor binding; double-stranded DNA binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding transcription factor activity